PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 39427
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family bZIP
Protein Properties Length: 85aa    MW: 10273 Da    PI: 11.5244
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
39427genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_151.62.1e-16446547
            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
  bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47
            +r+rr++kNRe+A rsR+RK+a++ eLe +v +L++eN++L+k
   39427  4 RRQRRMIKNRESAARSRARKQAYTVELEAEVTQLKEENMKLRK 46
            69***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5021710.932246IPR004827Basic-leucine zipper domain
SMARTSM003387.8E-11264IPR004827Basic-leucine zipper domain
CDDcd147072.74E-18449No hitNo description
PfamPF001704.1E-14446IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.38E-12446No hitNo description
Gene3DG3DSA:1.20.5.1702.6E-16447No hitNo description
PROSITE patternPS000360722IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
IVERRQRRMI KNRESAARSR ARKQAYTVEL EAEVTQLKEE NMKLRKMQVR NEFFLRDFSQ  60
QALEVITPMT QHLPKMLKRT LTGPW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002964990.15e-42hypothetical protein SELMODRAFT_266892
RefseqXP_002977062.17e-42hypothetical protein SELMODRAFT_443424
SwissprotQ6ZDF37e-26TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLD8R1216e-42D8R121_SELML; Putative uncharacterized protein ABI5C-1
TrEMBLD8S1868e-42D8S186_SELML; Putative uncharacterized protein ABI5C-2
STRINGEFJ216712e-41(Selaginella moellendorffii)
STRINGEFJ338282e-41(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP10063711
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.16e-23abscisic acid responsive elements-binding factor 2